PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013595685.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 330aa    MW: 37439.2 Da    PI: 8.4759
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013595685.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31195250156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W++eLH+rF++a+++LGGs+ AtPk+i++lm+v+gLt+++vkSHLQkYRl+
  XP_013595685.1 195 KQRRCWSSELHRRFLHALQRLGGSHAATPKQIRDLMQVDGLTNDEVKSHLQKYRLH 250
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.638192252IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-27193253IPR009057Homeodomain-like
SuperFamilySSF466892.57E-17193253IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-27195250IPR006447Myb domain, plants
PfamPF002497.9E-7197248IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAKKGDNMDY TLKKKRREEY IEALEEEQKK IQVFKRELPL CLSLVTQAIE SYRKELSEFS  60
RSEHIQSEGS ERTTSEFEGR DGCIALSEEF VPIKSCERVK DDEAENNVDK KKSEWLQLWN  120
QSPDPQPIED QTTTVVAAEV NENCGAFQPF QKGKLAYSQP LKAITPTPTA SSSTAETGGN  180
KKEMEQQKQL QMHRKQRRCW SSELHRRFLH ALQRLGGSHA ATPKQIRDLM QVDGLTNDEV  240
KSHLQKYRLH TRRPATPTLT NGCESPQQQQ LIVVEGIWVP SKDGVNNRVY APVAVQPPPR  300
SSPSEPRSIQ RCKPPTASSS THPSHLLPLS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11216KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894761e-124AC189476.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB080N15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595685.10.0PREDICTED: uncharacterized protein LOC106303881
TrEMBLA0A0D3D6R40.0A0A0D3D6R4_BRAOL; Uncharacterized protein
STRINGBra012471.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-110G2-like family protein